PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G02980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 385aa    MW: 42268.1 Da    PI: 9.8977
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G02980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.94.5e-08292350563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +r +r   NR +A +s ++K +++eeL++k+ +L++e  +L  ++  ++k+  +l s++
  OPUNC04G02980.1 292 RRVKRILNNRASAAKSKEKKMKYTEELQRKFHVLQSETATLCAQVTVMQKNRNELVSQN 350
                      6789999***********************************99999999999888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.1E-12288352IPR004827Basic-leucine zipper domain
PfamPF077163.0E-7289340IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967290353IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-8292357No hitNo description
SuperFamilySSF579593.75E-9292343No hitNo description
CDDcd147036.85E-19293344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEGEPSRRLS LLDRCGNGRK NPVVPPRVPS ILNLASHKRL DRSKFLPFIH PAPTCFTSST  60
VSALSPYSEP PPFAPTIEVS SGFGPEDFYS FFPNPFFSME SIGPPPYDAL DVPPLTSLAL  120
RSVRSNQGPP SRLPLMVGHR RSHSDIPLGY SHQNPQMLPV ASVKPKVTMT EGNQSESVAT  180
VALKDMGLQA WSPSGSREKE ARSSGAGSRI YHGHGLSVDS FMMGNLNFGA VGQQMSSLPL  240
LTTEANGGGG ESISRVVSPY AAELANVKFT EDDKKKVVAD KSLSEIVLTD PRRVKRILNN  300
RASAAKSKEK KMKYTEELQR KFHVLQSETA TLCAQVTVMQ KNRNELVSQN NELKTRLQAM  360
DQQAQWGDGN FSSLFFCIHL FSFSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635275.10.0PREDICTED: uncharacterized protein LOC107275813
TrEMBLA0A0E0KMX30.0A0A0E0KMX3_ORYPU; Uncharacterized protein
STRINGBGIOSGA015977-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147931112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.24e-31bZIP family protein